Loading...
Statistics
Advertisement

www.otoclubtr.com
www.otoclubtr.com/

Otoclubtr.com

Advertisement
Conversion Technology Metas Server
Otoclubtr.com is hosted in Turkey . Otoclubtr.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 3. First javascripts: Showhide.js, AC_RunActiveContent.js, Flash.fix.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/6.0.

Technologies in use by Otoclubtr.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Swf Object

Advertisement

Javascripts

Number of occurences: 3
  • showhide.js
  • AC_RunActiveContent.js
  • flash.fix.js

Server Type

  • Microsoft-IIS/6.0

Powered by

  • PleskWin

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Otoclubtr.com

Missing HTTPS protocol.

    Meta - Otoclubtr.com

    Number of occurences: 6
    • Name:
      Content: webmaster@turk.net
    • Name: Pragma
      Content: no-cache
    • Name: description
      Content:
    • Name: keywords
      Content:
    • Name: Abstract
      Content: turk.net; size özel Internet.
    • Name: robots
      Content: ALL

    Server / Hosting

    • IP: 193.192.122.120
    • Latitude: 41.02
    • Longitude: 28.99
    • Country: Turkey

    Rname

    • ns4.turknetserver.com
    • ns3.turknetserver.com
    • smtpgw.turknetserver.com

    Target

    • dnsadmin.turk.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 24 Apr 2016 18:58:23 GMT Server: Microsoft-IIS/6.0 X-Powered-By: PleskWin X-Powered-By: ASP.NET X-AspNet-Version: 2.0.50727 Cache-Control: private Content-Type: text/html; charset=utf-8 Content-Length: 25158

    DNS

    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 193.192.122.120
    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns4.turknetserver.com
    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns3.turknetserver.com
    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns3.turknetserver.com
    5. rname: dnsadmin.turk.net
    6. serial: 2015060300
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 10800
    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 10
    5. target: smtpgw.turknetserver.com
    host: otoclubtr.com
    1. class: IN
    2. ttl: 86400
    3. type: TXT
    4. txt: v=spf1 ip4:193.192.122.115/32 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.toclubtr.com, www.obtoclubtr.com, www.btoclubtr.com, www.ohtoclubtr.com, www.htoclubtr.com, www.ogtoclubtr.com, www.gtoclubtr.com, www.ojtoclubtr.com, www.jtoclubtr.com, www.omtoclubtr.com, www.mtoclubtr.com, www.o toclubtr.com, www. toclubtr.com, www.ovtoclubtr.com, www.vtoclubtr.com, www.ooclubtr.com, www.otqoclubtr.com, www.oqoclubtr.com, www.otaoclubtr.com, www.oaoclubtr.com, www.ot oclubtr.com, www.o oclubtr.com, www.otwoclubtr.com, www.owoclubtr.com, www.oteoclubtr.com, www.oeoclubtr.com, www.otzoclubtr.com, www.ozoclubtr.com, www.otxoclubtr.com, www.oxoclubtr.com, www.otcoclubtr.com, www.ococlubtr.com, www.otclubtr.com, www.otobclubtr.com, www.otbclubtr.com, www.otohclubtr.com, www.othclubtr.com, www.otogclubtr.com, www.otgclubtr.com, www.otojclubtr.com, www.otjclubtr.com, www.otomclubtr.com, www.otmclubtr.com, www.oto clubtr.com, www.ot clubtr.com, www.otovclubtr.com, www.otvclubtr.com, www.otolubtr.com, www.otocdlubtr.com, www.otodlubtr.com, www.otocrlubtr.com, www.otorlubtr.com, www.otoctlubtr.com, www.ototlubtr.com, www.otocvlubtr.com, www.otovlubtr.com, www.otocflubtr.com, www.otoflubtr.com, www.otocglubtr.com, www.otoglubtr.com, www.otochlubtr.com, www.otohlubtr.com, www.otocnlubtr.com, www.otonlubtr.com, www.otocmlubtr.com, www.otomlubtr.com, www.otocjlubtr.com, www.otojlubtr.com, www.otocubtr.com, www.otocluubtr.com, www.otocuubtr.com, www.otocl8ubtr.com, www.otoc8ubtr.com, www.otocl9ubtr.com, www.otoc9ubtr.com, www.otocljubtr.com, www.otocjubtr.com, www.otocl0ubtr.com, www.otoc0ubtr.com, www.otoclmubtr.com, www.otocmubtr.com, www.otoclpubtr.com, www.otocpubtr.com, www.otocloubtr.com, www.otocoubtr.com, www.otoclbtr.com, www.otocluwbtr.com, www.otoclwbtr.com, www.otocluebtr.com, www.otoclebtr.com, www.otoclusbtr.com, www.otoclsbtr.com, www.otocluabtr.com, www.otoclabtr.com, www.otoclutr.com, www.otoclubqtr.com, www.otocluqtr.com, www.otoclubwtr.com, www.otocluwtr.com, www.otoclubztr.com, www.otocluztr.com, www.otoclubxtr.com, www.otocluxtr.com, www.otoclubtr.com, www.otoclutr.com, www.otoclubstr.com, www.otoclustr.com, www.otoclubytr.com, www.otocluytr.com, www.otoclubetr.com, www.otocluetr.com, www.otoclubdtr.com, www.otocludtr.com, www.otoclubctr.com, www.otocluctr.com, www.otoclubr.com, www.otoclubtqr.com, www.otoclubqr.com, www.otoclubtar.com, www.otoclubar.com, www.otoclubt r.com, www.otoclub r.com, www.otoclubtwr.com, www.otoclubwr.com, www.otoclubter.com, www.otocluber.com, www.otoclubtzr.com, www.otoclubzr.com, www.otoclubtxr.com, www.otoclubxr.com, www.otoclubtcr.com, www.otoclubcr.com, www.otoclubt.com, www.otoclubtri.com, www.otoclubti.com, www.otoclubtro.com, www.otoclubto.com, www.otoclubtrl.com, www.otoclubtl.com, www.otoclubtrl.com, www.otoclubtl.com, www.otoclubtr..com, www.otoclubt..com,

    Other websites we recently analyzed

    1. hacapm.com
      Road Town (Virgin Islands, British) - 208.91.197.39
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. www.551010.net
      Los Angeles (United States) - 104.160.182.132
      Server software: nginx
      Technology: Html, Iframe
      Number of meta tags: 1
    3. ParadiseLair – Dream Travel – Exotic places you need to see
      Houston (United States) - 108.167.181.36
      Server software: nginx/1.8.1
      Technology: Google Adsense, CSS, Font Awesome, Html, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 3
    4. Welcome to Cat9Sound - Cat9sound
      San Francisco (United States) - 199.34.228.59
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 1
    5. Figulinas: Home
      Associazione Culturale Gruppo Folk Figulinas, di FLORINAS
      Germany - 217.160.230.187
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 7
      Number of meta tags: 6
    6. Stellar Publishing e-Store
      Houston (United States) - 192.185.170.161
      Server software: nginx/1.10.1
      Technology: Html, Php
      Number of meta tags: 1
    7. DPMCUSA | Best Credit Repair | New York | New Jersey | Pennsylvania
      Best Credit Repair Serving New York Buffalo Albany Jersey City Newark Pittsburgh & Philadelphia. Services Nationwide. Get the Best Results. A+ Rating.
      Burlington (United States) - 66.96.161.132
      Server software: Apache/2
      Technology: CSS, Google Font API, Javascript
      Number of Javascript: 3
      Number of meta tags: 5
    8. Willkommen bei PPE-Trading
      Zurich (Switzerland) - 217.26.52.41
      Server software: Apache/2.4
      Technology: CSS, Html
      Number of meta tags: 10
    9. J Collins Kerr | www.jcollinskerr.com | Home
      Beaverton (United States) - 67.51.200.171
      Server software:
      Technology: CSS, Html, Javascript, jQuery UI, Share This Social Media Buttons
      Number of Javascript: 9
      Number of meta tags: 3
    10. valentinesdaywishesmessagespics.com
      Scottsdale (United States) - 104.238.72.112
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1

    Check Other Websites